DPCstruct | MC24508
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 349 ± 79 aa |
| Standard deviation of domain lengths | 78.94 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 73.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 33.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08118 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L6P891 | 1-306 | MEDLLLTVHQPGGFRPFSISIFSCELPQLRKQWLFYDFLSANHMSGSYDGSLFTIHPRQVHGVVPSGNGDPEASVGFGDPKAWKKFS… |
| A0A2H3IRY6 | 49-407 | QFDVSIDTVNVTLSFTKWFNGKGLLRDVEVKGIRGVIDRTHVHWTDYNADPKSYRHEHNPGDFEIDSFKMEDLLVTVYQPNNFRPFA… |
| A0A0E9NMH0 | 358-713 | None |
| A0A098VUL1 | 76-474 | None |
| M5G2G0 | 474-843 | None |
| R1GWS4 | 1-216 | None |
| A0A0C2YWI5 | 72-365 | None |
| A0A0F7S270 | 696-1146 | None |
| A0A4T0EWP6 | 177-517 | None |
| H0EXF3 | 2-233 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.