DPCstruct | MC24502
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 282 ± 40 aa |
| Standard deviation of domain lengths | 40.12 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 74.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A7S830 | 203-440 | ASMKDECEDLALKNLSLFTNDASGNLQPPREIGDNLCPNDCSGLGNCTNRTCICLDGYTGADCSLSKALVPELFGIYDGGLCDIRRR… |
| A0A1S3K9D2 | 2-308 | CTDAAKSSSAYTQCLATGKIDVNEIVGGCVDDMKISDGDTEFLSSVVTAFENTCQEKVLKDPNSYTKNATDGTLIMPAFVTADLCTT… |
| V4ATY6 | 774-1073 | None |
| A0A814E115 | 776-995 | None |
| V4B367 | 240-506 | None |
| A0A8B6EMJ7 | 731-1068 | None |
| A0A4Z2BNZ7 | 370-661 | None |
| A0A210PNV6 | 93-373 | None |
| A0A210PRX4 | 257-622 | None |
| A0A8B6C8U5 | 212-551 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.