DPCstruct | MC2450
Metacluster Properties and Pfam Annotations
| Number of structural domains | 142 |
|---|---|
| Mean domain length (aa) | 216 ± 53 aa |
| Standard deviation of domain lengths | 53.15 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 78.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 23.46 |
| Pfam Score | 99.32 |
| Assigned Pfam label(s) | PF00956- CL0071 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L1KS02 | 24-248 | LPVEVRCRTYALMSVGKQLSAVKDAHLSNVFKLQKDNEELLRKLYEERRKVVDPNGGLGGVPGFWLNCLLKNETTAPMISSRDKEAL… |
| G8JML1 | 6-179 | EVTASALQALSELEDEMEAVELELEKQRKVLLAPVYKKRSAVIEGIEGFWRIVLTQHGEFANYIRACDFRYVEAIRRVEVEWRWTER… |
| M2Q344 | 15-235 | None |
| H0EIX9 | 6-235 | None |
| A0A2P6RY58 | 5-170 | None |
| A0A4Y7JS83 | 23-251 | None |
| A0A022R1L5 | 22-177 | None |
| A0A5N4A6W3 | 15-169 | None |
| A0A504X645 | 36-298 | None |
| A0A2P5FEC0 | 16-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.