DPCstruct | MC245
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 82 ± 9 aa |
| Standard deviation of domain lengths | 8.54 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 38.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M8VK79 | 1-74 | MRLADVVRHVVRRYFDDMGETQPDNLHKLVMNEVERSLIETVLVHADGNQSRAAEMLGITRTTLRNRVRRYQLD |
| A0A2E8UH35 | 26-106 | TPISDTQRSLREMVEQSINQYFENLGGHETIDLYDLVLKEVELPLLIAVLKQTKNNQSKASKILGLNRGTLRKKLKQYNLI |
| A0A7Y5D7G8 | 70-154 | None |
| A0A0S8CUL8 | 3-89 | None |
| A0A257PKE4 | 9-108 | None |
| A0A661NL45 | 119-205 | None |
| A0A7C7W8K1 | 140-218 | None |
| A0A2E6YAX3 | 13-100 | None |
| A0A1T0CN87 | 3-84 | None |
| Q2IG48 | 24-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.