DPCstruct | MC24498
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 119 ± 10 aa |
| Standard deviation of domain lengths | 10.17 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 33.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C3Y5Y1 | 9-128 | CRSDNYNYRDILAQSICTAATNQLSFVFAIRRNCGGNGDGLTCNAMCASRRAAMIAAVGNQGRTSECFDAVLVYGNRPVLSSDHNTD… |
| A0A1S3JX26 | 8-145 | SFLIAAVCGEATWDHYDYNYNYLDEMAESFCTSVAPAASMVYAVRRNCSGQTPSCDGVCRALAGTMREDVKGNMGYSGSGCYEAIHI… |
| K1PC03 | 21-135 | None |
| A0A8B6HQF9 | 1-109 | None |
| A0A6P4YB82 | 60-179 | None |
| K1PV82 | 7-114 | None |
| K1PFZ4 | 16-133 | None |
| C3ZMM8 | 29-162 | None |
| A0A7M5XBV8 | 28-151 | None |
| A0A2B4S643 | 384-506 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.