DPCstruct | MC24491
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 81 ± 12 aa |
| Standard deviation of domain lengths | 11.66 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 27.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L5KXF0 | 160-230 | VTPHRYMLQSGNEKDCIDVAILAEGYTEKEMDIFYQDAQRTCESLFSYEPFRSMKGKFNIVAVASPSTDSG |
| A0A351PWL0 | 24-103 | SNAQVFSVDTLMRNGERNNRVNLVYLSDGYTAAEITNYIGNATAINNALFLQTPFAQYKNFFNVYAIKVPSAQSGAVHPG |
| A0A3M1HVZ6 | 1-123 | None |
| A0A3M1B1J1 | 571-659 | None |
| A0A1F9BFG3 | 351-424 | None |
| A0A5D6XW91 | 120-187 | None |
| A0A521GTY2 | 296-376 | None |
| A0A661LQI1 | 18-98 | None |
| A0A0D0V5X2 | 76-154 | None |
| A0A1Y4H582 | 501-581 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.