DPCstruct | MC2449
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 85 ± 7 aa |
| Standard deviation of domain lengths | 7.20 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 58.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0194 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397GY52 | 195-280 | MPINRIWDHYEIAKQGYSTESAKHMHEVTEYCIIDALRCQQLLVKRNVINDNREVASIAYVSLFDAHYRANGMKVCNLLGAEAWKQ |
| A0A372RKA4 | 192-274 | KSISTLWKYYSEARDGTSDSSIKNMQEIAKYCVIDALHCQELMVKNNIINDYREVASIVYISLFDTHYYAIGIKVSNLLGAEA |
| A0A2Z6Q9C4 | 442-523 | None |
| A0A2N0S7W1 | 1-82 | None |
| A0A2N0S0P9 | 1-77 | None |
| A0A397IXS1 | 2-82 | None |
| A0A2H5S770 | 257-342 | None |
| A0A2Z6RLX4 | 141-226 | None |
| A0A2I1FF19 | 1-83 | None |
| A0A372QNI6 | 275-355 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.