DPCstruct | MC24488
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 140 ± 10 aa |
| Standard deviation of domain lengths | 10.29 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 33.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01295 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A109LIU4 | 240-390 | MTEFELFNLLGSLQQTITLPLASVDEVRLLRPAVPEEVLLLINVGIDPLKHHRDLNILMTTERTDSLSYAGVRDNLVLTLDQVTLNS… |
| A0A1V5ED05 | 1-128 | MLPNATSITLQEIVNLGRKVRDFFGISDIAAVEFPNYLEDERIQKALIVVNFETAGYGKEIRDLRLIFRNNRGELFVRRWGSPEALK… |
| A0A6I4KMG4 | 291-439 | None |
| A0A7V5HA50 | 108-256 | None |
| A0A355B1N9 | 626-767 | None |
| A0A6M1HV82 | 2-120 | None |
| A0A2X1PHN5 | 1-149 | None |
| A0A090PMH9 | 89-237 | None |
| A0A6L2ZQ34 | 520-668 | None |
| A0A376YK75 | 4-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.