DPCstruct | MC24483
Metacluster Properties and Pfam Annotations
| Number of structural domains | 79 |
|---|---|
| Mean domain length (aa) | 180 ± 36 aa |
| Standard deviation of domain lengths | 36.29 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 85.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 23.32 |
| Pfam Score | 60.00 |
| Assigned Pfam label(s) | PF07179- CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C6LKK8 | 420-635 | DDQLGARRLDRSEHDKLRLTRTNELTEAQARDVVEVRDAIKLDEGRMVTKVIDPKMMQAYLDNATKLGKYDFKPGEFRGSIARGCDT… |
| A0A7W9UEM7 | 39-250 | QFDEIRQRPVESYTAAEVEAIRDVRDGVETPPGEVVQRVLTGEVAANYLQNNPVFIPDGSGGQRQIFDPTEAGGFTTRYRDVAELRS… |
| A0A1H7VX69 | 121-341 | None |
| A0A139NZU8 | 57-234 | None |
| A0A358SRX9 | 2-138 | None |
| A0A1R4FCB3 | 4-157 | None |
| A0A3N2IAM6 | 7-178 | None |
| A0A1H7UAF3 | 2-152 | None |
| A0A4S8QFA2 | 85-267 | None |
| A0A512PF88 | 382-573 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.