DPCstruct | MC24479
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 206 ± 40 aa |
| Standard deviation of domain lengths | 39.50 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 77.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 26.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V6MDV8 | 1-199 | MKKMVSSVLALSLLLGGVSVAGAEAKQDKSAAQEVRKQNKEAKQQEKWTKAVEEATKLGLGTDGKTLEQLKLEIKAKHEEQQQARLA… |
| A0A7Z1KFK4 | 1-206 | MGGASACTNKEVDKEIQSSQPSSAQVNNEAIHAAYTEDKAQNLGISTEGKELLTLEKEIHETEVEKEANQLGVSTEGKDVGTLSEEI… |
| A0A292YRS8 | 3-151 | None |
| A0A559JFD6 | 2-214 | None |
| A0A4R2BKL1 | 12-233 | None |
| A0A398B296 | 1-237 | None |
| A0A221M8C1 | 1-212 | None |
| A0A1H2U5W7 | 2-204 | None |
| A0A4R5KTI5 | 2-186 | None |
| A0A4Q9DVC8 | 1-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.