DPCstruct | MC24478
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 93 ± 7 aa |
| Standard deviation of domain lengths | 6.51 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 42.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V6GXW8 | 7-92 | NAKRILLYLFQTGEERTRAQIIKDLNLDMTDFELQTKLQKLMKADLISRGETYFDYKIEKDKTYELVFRRLYQEEIDDFIPDIRKE |
| A0A0A6PEH9 | 108-205 | VNDRYAKQILLFLSRKREKECTRKEISDHLQGKLLERELEKKLNALEAGDLITQGSSNFRYRGIPDDILDLIFRSLYEEEIHGKIPD… |
| A0A484HKX4 | 123-223 | None |
| A0A484HDA1 | 37-127 | None |
| A0A4E0RQ01 | 55-155 | None |
| A0A496UX16 | 1-92 | None |
| A0A1W9XCH2 | 64-159 | None |
| A0A7X5W3Z0 | 162-240 | None |
| A0A1W1HHL2 | 80-177 | None |
| A0A1W1HEF8 | 93-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.