DPCstruct | MC24473
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 269 ± 51 aa |
| Standard deviation of domain lengths | 51.41 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 88.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 27.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13651 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B3RJ83 | 2-240 | FARWFAVHADMLGLRSLTCTRWNPDAHSLFHPDACGGRWDWTGAGWEHSHLAGDGSYASRECLQVSRRADLVCTNPPFSRFTDYVPR… |
| A0A422M0U1 | 13-224 | LRVPLKHGGDFRSEECINYLQQADIVITNPPFSLFREYMAQLMKYKKQFLIIGNENAITYKEIFPLFQQNKLWFGYNNGHYWFRVPS… |
| R6R011 | 13-347 | None |
| A0A7V1ZFH5 | 1-298 | None |
| A0A2S0WY38 | 7-393 | None |
| A0A1I7IFI2 | 65-413 | None |
| A0A829EF87 | 2-179 | None |
| Q50290 | 39-319 | None |
| A0A5C8FW30 | 156-424 | None |
| A0A6I0VB61 | 196-464 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.