DPCstruct | MC24472
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 104 ± 7 aa |
| Standard deviation of domain lengths | 6.86 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 93.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 31.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V9CHI4 | 12-112 | ETHRQRNLLECLQGFADCERSLLSPAEAAEVGKIDRQRNLLACETGSDRCHRAWLAPSEAEEVGSLEHRRNLLNCDTGNSFCDPLRL… |
| A0A653Y0Q3 | 20-122 | AQDAKLSQNYRLREAGYSSCDISLLDARQLELVRRAALARNFRYCDRGYARCDMTMLTEHQRAQVDASAQAKKFRYCDSGYSSCNQS… |
| A0A317GZQ4 | 36-140 | None |
| A0A2V7TSR3 | 1-97 | None |
| A0A5C7P0Y1 | 215-322 | None |
| A0A0S4V0U0 | 22-129 | None |
| A0A7V8NU05 | 27-115 | None |
| A0A5M8SCH5 | 302-411 | None |
| A0A2V8ZVR0 | 113-220 | None |
| A0A4Y9S1F1 | 115-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.