DPCstruct | MC24471
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 274 ± 38 aa |
| Standard deviation of domain lengths | 38.04 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 16.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S6T5P0 | 3-282 | KIKIQINHTTPITISVLSPLLYDEIGEEYNIELDTIKGYFDFEYVCALPNDSFISIVTFQLPKFELRDIELKDIVFSFLSSVKNLDN… |
| A0A653W598 | 1-296 | MKSEYLITFDSKDGICTSVDKFKNLLASHTSISLNKKEKIGFNGRDFPYQLAQGTLTDGSLYYDLTIEDTEPSEREIYTSLLKEVRR… |
| A0A4V3RRL4 | 2-304 | None |
| A0A563CWE9 | 4-298 | None |
| A0A143Z2B4 | 7-316 | None |
| A0A223N2V1 | 4-277 | None |
| A0A2V4WP97 | 32-316 | None |
| A0A164HTX3 | 9-263 | None |
| F0IJ91 | 5-307 | None |
| A0A7X8FFX3 | 12-299 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.