DPCstruct | MC2447
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 108 ± 12 aa |
| Standard deviation of domain lengths | 11.85 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 72.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 36.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I1HKM7 | 2-89 | ANTILNPRDPHNAHDGKQVSLVSLSLNGKYAVTYSEDDKSIEGWIVENSEPILDHEANVYKLPKEWTYIYEIKVNDSKIVCYSSYDNN |
| A0A372RER6 | 9-99 | VPMNTNNIIESNRNSITDKPHNNKPITKIEISPGGRYLVTYSQEDHSVVGWNIEDVDEGQLKPNDSVKINYEINQICVSDDKKLAYI… |
| A0A2I1EHP5 | 1-114 | None |
| A0A2N1NQ15 | 18-117 | None |
| A0A2N1P3C5 | 60-172 | None |
| A0A2I1GQK6 | 7-126 | None |
| U9U3V8 | 1-108 | None |
| U9URD4 | 16-120 | None |
| U9UZD4 | 1-99 | None |
| A0A2I1EH66 | 3-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.