DPCstruct | MC24469
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 241 ± 48 aa |
| Standard deviation of domain lengths | 48.13 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 83.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 13.43 |
| Pfam Score | 64.44 |
| Assigned Pfam label(s) | PF04245- PF14199 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T0CN25 | 1-176 | MIIHKFIVHVLDKNSEVPILNDFEGKVSQEVDKFFQKIIKRVSKDDDLRKGIFKDYENNVVKNCCEQIIYDESTFLENSKEIAAYLF… |
| A0A395TJP7 | 22-236 | IKKLYVYDIDVSQKIPTHVTQSEQMSDLGSFLLRVSQETMTSPNKKLYEFEPTSSAQTCIKEFLTATTQAEEEISSMNLAKLLLDAE… |
| A0A7C9TRP3 | 1-189 | None |
| A0A6N6X733 | 1-162 | None |
| A0A0C5XUU0 | 2-193 | None |
| R7QZL6 | 1-260 | None |
| A0A352NVG8 | 4-237 | None |
| A0A7X5RJV8 | 2-167 | None |
| V9W7T6 | 1-205 | None |
| A0A3D4JLE4 | 1-270 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.