DPCstruct | MC24468
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 104 ± 7 aa |
| Standard deviation of domain lengths | 6.57 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 26.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y1ZJI8 | 136-237 | DDLGDRGGTLQFLQQYIAEQGAATVMTAVVYMKPQAMELCPADFYFGEVAQDCWIITPREAVETLVKRVPVWRERGADVAECRRRLV… |
| X1GVU4 | 16-126 | IFFLTDKSSKLTKRILEYSEEAYLQMAAIDHIKEMGAKEIRTSTLYYKKHSVIKPEYYIKETKAWIVYPWEYGEFAAFQYDQLKEKM… |
| G9EUJ3 | 4-105 | None |
| A0A2J4G6Q5 | 73-185 | None |
| A0A7J3BDK8 | 73-170 | None |
| A0A645HSQ8 | 2-101 | None |
| A0A7C0XH22 | 46-148 | None |
| A0A7J3JBA2 | 194-288 | None |
| A0A2D6V4P6 | 178-268 | None |
| A0A843I824 | 39-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.