DPCstruct | MC24464
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 189 ± 19 aa |
| Standard deviation of domain lengths | 18.96 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 19.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J5BJV9 | 24-199 | LEQWLEVEFTFIQVDDLAASMATLPREDQDFLLGWVRRIATTNIQIAHQFALRAISQLAHMDRRMIEAWALHAMDTFDRAGSRPAFK… |
| A0A3N1Y7Q6 | 6-167 | VEAVEAQLDRLLEAVLSSRRTAAAPARALAGMAPAARAEALRWVEVLAAAHPELAYRLALMAPAVWRVADAALREAWLREALDAYDR… |
| A0A259RXM1 | 65-283 | None |
| A0A532CMQ3 | 233-452 | None |
| A0A3M1WSH3 | 281-475 | None |
| A0A7C7MLB8 | 221-420 | None |
| A0A1E7GS16 | 15-202 | None |
| A0A3M1UJL9 | 285-473 | None |
| A0A401G3Z2 | 158-363 | None |
| A0A353XB17 | 1-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.