DPCstruct | MC24460
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 99 ± 11 aa |
| Standard deviation of domain lengths | 10.56 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E0SCS4 | 1-102 | MGQTTLEITATGQTPVGFERVFGKKVQVFGLTVFATRSTSDSKLLHAANVLAQYLDNDADGIADNKLVLKSLQKERGAVVMFASQRE… |
| A0A2D6Y1S9 | 1-100 | MTFADQLRPHFDSIDDVFGVTIAASRAVGKDKRAHAAAILSEYLDNNEDGIADNPAVVRELKQHNAAVLMYGTPEEADAAEKTLERS… |
| A0A2E4ZYA5 | 18-130 | None |
| A0A2E0XSL3 | 25-98 | None |
| A0A2D5X0Y8 | 196-285 | None |
| A0A432FFS9 | 10-118 | None |
| A0A2E1H6Y3 | 242-335 | None |
| A0A2V4D737 | 725-822 | None |
| A0A2D8VCP9 | 4-112 | None |
| A0A6B3L9N9 | 697-799 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.