DPCstruct | MC24456
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 156 ± 19 aa |
| Standard deviation of domain lengths | 18.57 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 32.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11241 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A556QIH4 | 171-332 | MTQAQRAQKNKELKASMSKEEWKAYKKEQRAENRRANKEIQARIDAGDERYLMDRDKGEVRRYVRDWVDARRFFNNYVMPVALVLVV… |
| A0A848DM94 | 1-155 | PRTQREAARLARANRPDKEQRRRAAAERRERMAAGDDRFLMPRDRGPVKAYIRDLVDSRPHLMGLFMPLAGVVLLSVLLPIPAAQQY… |
| A0A7Z0KDB2 | 44-195 | None |
| A0A6N7GSY5 | 22-166 | None |
| G8S854 | 32-203 | None |
| A0A4Q5IWN2 | 90-256 | None |
| A0A7K1E6K0 | 2-114 | None |
| A0A561U4A4 | 8-146 | None |
| K9EH58 | 30-208 | None |
| A0A359F9Z5 | 109-271 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.