DPCstruct | MC2445
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 139 ± 12 aa |
| Standard deviation of domain lengths | 12.01 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10049 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F2GJN4 | 2-147 | FKIIKKEYNQQEKLIYKTDTKELIATPTIASDITFSFIYLFLGFNSENMESTQFWGYHNDFSWIKRSLVPPKFDKGVIVVTDNDING… |
| A0A372RBM7 | 27-173 | SDWPDIIFRHYKDTDDLGIYFIKVTPGVLKISDNSLDDLLVSYDHNRKIISIDLDIISSLFHSNMFTVDGLLNAKFIKPIYDEDSDT… |
| U9U139 | 207-349 | None |
| A0A7X9FDL8 | 4-139 | None |
| A0A1S2M964 | 2-149 | None |
| U9SZ88 | 289-424 | None |
| A0A397IYB1 | 40-167 | None |
| A0A372Q2V5 | 49-191 | None |
| A0A397SF67 | 1-143 | None |
| A0A1F2RM47 | 7-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.