DPCstruct | MC24444
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 93 ± 5 aa |
| Standard deviation of domain lengths | 5.32 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 42.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N7AJK2 | 886-989 | TWGGGGLGDPLTRPAEKVALEIRRRLVTVDGARNNYGVVVNPDDLSVCEEETVALRKSMKEARDALGQTPEYDRGGSMEELRESCLR… |
| A0A0S6X5M2 | 1-89 | DRDPALVLTEIGQGLVTETGALDYGVVIKDGAVDETATQALREKMRTERGEVEVFNFGPDIETLRKNCLEETGLPAPKQPMWRTAEA… |
| A0A6S6Y2V7 | 115-203 | None |
| A0A3M7AQI4 | 201-297 | None |
| A0A7C3C1E0 | 206-291 | None |
| A0A146IN89 | 324-415 | None |
| A0A0N8KHN3 | 22-111 | None |
| A0A3F3R8Y1 | 177-269 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.