DPCstruct | MC24443
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 92 ± 10 aa |
| Standard deviation of domain lengths | 9.92 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 46.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0104 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G2DTF4 | 521-617 | KFVKQRLEEKGFKLNSDGEILKVSQDGLLFQVSSISERLPVTFADGVTETIPASYIEFTQRQVLPEFKDVPLDEIKEFHRREAFELD… |
| A0A0S6WVD5 | 13-91 | KPIKDKVEHSASGRVHQTAFRADMVERPLRRADGAPVTRTVPGSFFEFITRDTLPGSEALDLGFDSGNATGIFAMTRTT |
| A0A087HR64 | 3-79 | None |
| A0A830HZM7 | 160-259 | None |
| A0A1M3HM82 | 986-1074 | None |
| A0A061SJY8 | 754-829 | None |
| A0A7J7DJZ6 | 133-219 | None |
| A0A4S8J0H3 | 121-216 | None |
| A0A843TIH5 | 396-493 | None |
| A0A803MBH6 | 2-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.