DPCstruct | MC24441
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 151 ± 14 aa |
| Standard deviation of domain lengths | 14.26 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 59.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00223 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T2JVS6 | 65-200 | LFHVAWQGNFEQWITDPLNIRPIAHAIWDPQFGQGAIDAFTQAGASYPVNVAYSGVYHWFYTIGMTTNGDLYQGSIFLLVLSALFLF… |
| A0A1D6WKI3 | 27-165 | IFLWLSGMYFHGARFSNYEACLSDPTHIGPSAQVVWPIVGQEILNGDVGGGFRGIQITSGFFQIWRASGITSELQLYCTAIGALVFA… |
| A0A0B2PS33 | 2-142 | None |
| A0A446KWE8 | 2-141 | None |
| A0A4S8I2Y4 | 427-587 | None |
| A0A6A4NJK4 | 39-185 | None |
| A0A2U1PTW1 | 384-519 | None |
| A0A2U1PV07 | 60-214 | None |
| A0A5J5BHJ5 | 88-218 | None |
| A0A4D6LEZ3 | 241-401 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.