DPCstruct | MC2444
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 230 ± 33 aa |
| Standard deviation of domain lengths | 32.64 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 17.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03661 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A372R9J3 | 15-231 | KHPQFTWWCGHSYLGAMLSYGVVVYKSFGSPQLNWEYFQKINKDENVFYLTLALMWFMSTPVFVTLIPYATFSLFHFITYLRANILQ… |
| Q236B6 | 87-314 | HHHKEESKFKSTLKKVAYSVENYLKVIFMLTFFNTRVVAQYASIIICILAIIRQLKRPRYTKQYVQQLAQNQFSQNLVYMLVFAFHS… |
| A0A6N2AUX8 | 107-344 | None |
| I2H6R9 | 20-313 | None |
| Q5CUE5 | 63-296 | None |
| A0A146F094 | 1-182 | None |
| A0A177UHA4 | 9-259 | None |
| Q6FUQ1 | 7-262 | None |
| A0A1E3IF12 | 9-194 | None |
| B7XIE7 | 9-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.