DPCstruct | MC24435
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 254 ± 49 aa |
| Standard deviation of domain lengths | 48.51 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 73.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 25.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20163 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4T0VYD1 | 2-227 | VQLGIIGLILITNLSLTIFAVASYGSENGVGLIYHGECSTVKRLDQWIHLLINLLGTGMLSASNYCMQLQAAPTRENVDTAHKAGKW… |
| A0A0D2HHZ3 | 3-271 | PAGWKGSALLFSIYCAVVLAVNLGVLIWAATSKPRGVSDDGTVILRDGTDSDQCSSIQALNKWAHLVINLLSTVLLSGSNYCMQSLS… |
| A0A2J6TLL9 | 26-303 | None |
| A0A6A5ZXZ0 | 1-311 | None |
| A0A2T6ZRD9 | 6-249 | None |
| A0A1J9R7G3 | 400-685 | None |
| A0A420TRA0 | 29-238 | None |
| A0A0A2JI47 | 53-300 | None |
| A0A319ENH9 | 23-245 | None |
| A0A317T2I7 | 51-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.