DPCstruct | MC24434
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 133 ± 23 aa |
| Standard deviation of domain lengths | 22.65 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 35.78 |
| Pfam Score | 95.85 |
| Assigned Pfam label(s) | CL0179- CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3UEB7 | 6-91 | PRGMIAYKFPPEEATTIVEDITVQVGRTGALTPVAVLKPVLVAGSTISRATLHNEDEIKRKDIRIGDTVVVRKAGDVIPEVASVLK |
| A0A350I8F3 | 206-298 | VYRLNSRDKFDRMGYTAHHPRGSVALKEQKEGQITTLLDVVWQVGKSGVVSPVAILDPVDIEGAIVSRATLHNIDYIRSLDLKIGCN… |
| A0A837Q3Q1 | 22-175 | None |
| A0A1X6PJS6 | 531-677 | None |
| A0A835XV96 | 680-809 | None |
| W3Z9Y8 | 1-67 | None |
| A0A7V4UW92 | 18-149 | None |
| A0A0K2QZV3 | 6-145 | None |
| A0A485AQA7 | 56-182 | None |
| A0A1E4ZIW4 | 273-412 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.