DPCstruct | MC24432
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 208 ± 14 aa |
| Standard deviation of domain lengths | 14.00 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 73.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 27.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I7CNS8 | 33-255 | VDDAYFVAEDSDRDRNIIELDFTQIKHRQESVMIKHLADGIAPTAWESLEVLVTDGGEVSPQDIADETGRHPGSVRRALNRIPELVE… |
| A0A1I6L9Q2 | 5-195 | LTRVEQQQESVVVRHLSDGLSPVQWDSLEMLVTDGGEVSPADIADQYGRHVESVRRALREMKDLVVSEYADVKLRSEYVAEMVHEAV… |
| A0A238XM07 | 340-535 | None |
| A0A498FDQ7 | 202-410 | None |
| A0A256I804 | 407-622 | None |
| A0A4V1G025 | 134-353 | None |
| A0A1H1J4E8 | 6-187 | None |
| A0A371LJ28 | 478-701 | None |
| A0A1M5MPA6 | 378-593 | None |
| A0A6C0UC28 | 22-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.