DPCstruct | MC24430
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 89 ± 8 aa |
| Standard deviation of domain lengths | 8.33 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q2BF39 | 20-105 | LLDAPHIKQLPELPRGCEVTSLAMMLLDAGAKADKMTLAKQIKKVPFKQNGLHGNPYDGFVGNMYTYSLPGYGVYNGPIAELAEDY |
| R6U6I6 | 1-87 | MCQLPEYPNGCEAPSAVSLMNTVGVKISLKDFVDSCLPKADVHISFGCMFGPDPKKFYAGNPDAGKGGWGCYAPVIVKATEALPDVI |
| A0A1I0CCF4 | 150-242 | None |
| S0KBA5 | 61-147 | None |
| F2JKS0 | 40-123 | None |
| A0A5S9MG90 | 3-97 | None |
| A0A2U3DB25 | 299-385 | None |
| S4E6K3 | 31-140 | None |
| A0A6H2H404 | 63-150 | None |
| G9QIE8 | 20-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.