DPCstruct | MC2443
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 167 ± 25 aa |
| Standard deviation of domain lengths | 24.75 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 76.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 20.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M4BNU9 | 66-190 | RSLLASFGIKEAFVTVDYLEAIMRLPRHKVLSAKQVAACLKIYEIVSEDTTSLVSALDSFASQGMVLLDQTNQLIPAARLTFDDMEW… |
| A0A372QZS6 | 4-178 | LFRYMGVRDEIGIKDLILVIQNMVKMDKDKILSAIEITNIIRILEHIAKIQKENKREGNEREKLDGLLIPSTEDTLVNLHEIQFDDM… |
| A0A2T7PC49 | 43-194 | None |
| A0A0P0WGA6 | 1235-1413 | None |
| A0A1B1EUY9 | 408-537 | None |
| A0A1D6DTK9 | 849-969 | None |
| A0A317SK91 | 24-225 | None |
| A0A397U942 | 2-153 | None |
| A0A673KF74 | 9-198 | None |
| A0A815IQU8 | 203-417 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.