DPCstruct | MC24429
Metacluster Properties and Pfam Annotations
| Number of structural domains | 145 |
|---|---|
| Mean domain length (aa) | 110 ± 14 aa |
| Standard deviation of domain lengths | 13.98 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 27.21 |
| Pfam Score | 97.08 |
| Assigned Pfam label(s) | CL0123- CL0603- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5D2TBN9 | 69-186 | KVIDGKSVAKQIREEISAEVTKLKEAIGVVPGLAVILVGDRKDSATYVRNKKKACESVGIKSFEVNLPNDASEQEVLKYISDFNGDP… |
| A0A412AWW1 | 410-525 | IIDGKAVSAAVRAGAKQEVEALKAQGIQPGLAVVIVGDDPASRVYVNNKKKACAEIGIHSEEYALPKETTQEELLDLVCRLNDKKDI… |
| A0A5A9NF52 | 370-496 | None |
| A0A365N406 | 21-127 | None |
| A0A0D2MUA5 | 8-96 | None |
| A0A4U0VQE3 | 513-634 | None |
| A0A553MV03 | 16-134 | None |
| A0A182U3I7 | 3-100 | None |
| M9LXY8 | 531-653 | None |
| A0A6J0NHZ3 | 63-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.