DPCstruct | MC24428
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 416 ± 46 aa |
| Standard deviation of domain lengths | 46.12 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 15.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H7DMT5 | 4-433 | FQILHPLSQDDWRPVTAEFVFAPHADQQYIWPSFAEAEAARQSILRRMPTIALRVALAGTDPGDIDWQTREQLRFADATYTPTPWHE… |
| A0A2D8SHT9 | 1-453 | MTRLVVDNQLLDFLKSKSRDNPVCKVITDEIENPKDRYRRKDKKHFSGQVNFLGFSQDAPHFISYLTEDRLERMALANMSPWEANMR… |
| A0A1Q3TD53 | 1-461 | None |
| A0A358RXN2 | 300-765 | None |
| A0A843FV57 | 16-370 | None |
| A0A1G3M279 | 190-624 | None |
| A0A853YI55 | 116-502 | None |
| A0A6M3XSP8 | 76-450 | None |
| A0A849YVL6 | 9-371 | None |
| A0A0F9TDU8 | 14-423 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.