DPCstruct | MC24421
Metacluster Properties and Pfam Annotations
| Number of structural domains | 68 |
|---|---|
| Mean domain length (aa) | 224 ± 51 aa |
| Standard deviation of domain lengths | 50.96 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 67.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 22.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03909 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N4ULE8 | 12-208 | ATTRATTAAAEVAAEKVQYFRNFVKDKTVIGDLEKEQEKFCAEVDNNALKLGTVPWADLPDNLIAKKHILALSLDNRNFLRDAPAES… |
| A0A7J7JPV7 | 24-156 | ASVSAKAKELKKAVAENTIIGDFVKEQDKFVSEKKEKARASEAAVPPWVGYNEEEQMKTQMLALSNDKRNFLRNPPTGVQFHFDYNT… |
| A0A6J0UDQ4 | 1-263 | None |
| A0A7S3LMG7 | 179-373 | None |
| Q6C2W6 | 101-402 | None |
| A0A5B8MGZ0 | 27-306 | None |
| I3SI82 | 19-306 | None |
| A0A1A9UTN9 | 69-282 | None |
| A0A7R9NZI5 | 3-322 | None |
| A0A0K0E460 | 123-275 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.