DPCstruct | MC24419
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 100 ± 9 aa |
| Standard deviation of domain lengths | 9.09 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 39.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14750 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7Y6D8 | 2-91 | KAANINITKRLNATMSGYLPVHCICAMLHWRSFSKYSTSINEWVKTQMLECHTPIHPIVPHLLENFASSCIPSETYPHFNQSIDEQF… |
| A0A0N4UJ75 | 1-86 | MGVTQSLNEAHQGFLPANCITQLLTTRAFAKHSVPIQDWISAQIMECSTPLHPVIPELITAYAASCFQTSECQSSTLPLSEKFFIV |
| A0A5K3FK48 | 176-287 | None |
| A0A3P7EFB2 | 51-135 | None |
| A0A0R3T8S8 | 143-260 | None |
| A0A5B7D6H1 | 231-334 | None |
| A0A7R8ZBB5 | 600-702 | None |
| A0A0R3RPN0 | 441-543 | None |
| A0A6V7UD18 | 162-260 | None |
| A0A6G0I956 | 516-618 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.