DPCstruct | MC24417
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 91 ± 6 aa |
| Standard deviation of domain lengths | 5.54 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 79.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 54.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N4UHA4 | 19-110 | RGQTSQCSMNGRWISSKEGTTADCRHFKTSSGCGELICSTVRENMVSDQDNGIISGKNCDKLEIFGMKGQIVCGLITWIVEEGIHDA… |
| A0A3P7DJJ0 | 166-255 | SDPSECTWSGRWMGAFSAHNIYCRYDNHGHCGHLECSVNHFNYQAQNSTEISGDCCDQISLFGLKGKATCGYIAWFDNSETLVDSWY… |
| A0A0N5ATE5 | 51-147 | None |
| J9DSN1 | 79-165 | None |
| A0A2A2K0Q2 | 230-318 | None |
| A0A0N4ZCR1 | 162-252 | None |
| A0A2H2IE94 | 25-121 | None |
| A0A0R3RXC0 | 99-189 | None |
| A0A0N4UDV7 | 111-210 | None |
| A0A1I7T6T0 | 1-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.