DPCstruct | MC2441
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 163 ± 22 aa |
| Standard deviation of domain lengths | 22.00 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 75.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 49.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A372QHI2 | 66-239 | ENCEQKELLELKDDLEKLDYEMDISEIQRIRDFRISNSVITTTEFMEKYAQIIDLDEKELRIQFYEWMNENTTFCDECGIRWINNRF… |
| A0A372QXW4 | 2-165 | ILRNYWIENDYKIDIKEIKQILNFGVEYEVMKTKDFMKYYVTIKELDNEEIIKELKKWYNTNIIECPLYQKMILIKEAMDYNKEFEG… |
| A0A015KD82 | 178-343 | None |
| A0A015L700 | 93-280 | None |
| A0A015KFL1 | 50-227 | None |
| A0A015KDZ8 | 319-484 | None |
| A0A2I1GRR7 | 1-157 | None |
| A0A2N1M9T1 | 81-245 | None |
| A0A2N1M4B4 | 323-479 | None |
| A0A015J8J1 | 3-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.