DPCstruct | MC24407
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 109 ± 10 aa |
| Standard deviation of domain lengths | 10.34 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 29.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0213 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N4U825 | 74-192 | SCHSVMLVLLVAFIFVRRGESGDDGVPLTKCLAPSNVVPVVPRPLPLPTACKDKDPTICTAIFAVRSGAVAPNSVATNPFLVNPNCQ… |
| A0A0N4U2S2 | 9-110 | LPIRLEVIRRCERIITVVTNDSDETVEIVRPIIAASRCQDSDPFLCNALFAIPSDIAADNLDEAKDYKVSANCYEPSVIKIALNKCP… |
| A0A0B2VQX5 | 9-108 | None |
| A0A0B2VLX9 | 6-101 | None |
| A0A0B2VKJ0 | 1-99 | None |
| A0A183E7T1 | 1-114 | None |
| A0A0N4USA2 | 3-109 | None |
| A0A0N4US61 | 5-111 | None |
| A0A0N4UR56 | 2-126 | None |
| A0A0N4UPR3 | 1-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.