DPCstruct | MC24403
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 203 ± 21 aa |
| Standard deviation of domain lengths | 21.20 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 67.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 26.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04870 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7TR42 | 70-270 | QNIPIRDDHAEAIFQHWVDQAYSSLFAAIANQRLKTLKKPIRDDFGHCSKHATNIPLHAKCLSDLFNGNFKGKNFTRKKNSRLERYR… |
| A0A3P6STX0 | 1-195 | MNIPISTEAGMQLYERWVHQGISSIMSAVANQRAETLNEYERSRLYRCSKAAEDIHQHARCVIRVIDANPRPLHTEKRCTELFSLLY… |
| G0PFS6 | 3-248 | None |
| A0A183U0S7 | 8-225 | None |
| A0A4U5M2B2 | 10-195 | None |
| A0A0D8XQS5 | 18-214 | None |
| A0A183DZL9 | 23-199 | None |
| A0A016UER4 | 15-217 | None |
| A0A183DCN8 | 19-194 | None |
| A0A0N4T2X3 | 8-235 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.