DPCstruct | MC24402
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 283 ± 83 aa |
| Standard deviation of domain lengths | 82.51 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 71.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 24.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03985 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B1RV18 | 1-236 | MCSSELMSAQHSKVVPWMRKTQYISSEFNRFGVAADRQEIKVGYNLTKNKENLNLFRDRQSQINLIKKSFEDCKTPIRKHFSKKGVT… |
| A0A0N4U1T1 | 10-287 | MPTTVNDVSTSSSSFRRHSSLQDRHDEKSLKTDFLYRIKYTNALPDIPFDTKFLACPFVSLNRFVDYKPSSLEKNFKFELLAEADLG… |
| A0A820VNG6 | 247-416 | None |
| A0A183T8K1 | 1-186 | None |
| A0A4U0W281 | 1-379 | None |
| B6JYE9 | 12-411 | None |
| A0A1D2NL78 | 30-260 | None |
| A0A061RFK7 | 3-252 | None |
| Q2H6M4 | 2-434 | None |
| A0A6A4W996 | 2-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.