DPCstruct | MC24400
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 346 ± 47 aa |
| Standard deviation of domain lengths | 46.56 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 91.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1IQJ7 | 117-453 | FDPPGFVDDLTSAAEKRGWSDWISRQMDRAVKGTPSRNDGPRRQFLNPSKPSTPLVEPVTYKDISWTAFPRQVDVDTGSDSARWAAA… |
| A0A4V2LDU2 | 14-320 | DAPRPRFFNVAKTPLAADAVEKDISWTAFPRLVAIDAATDEERWKTADGSRDVQDEYCEWSVTRLADGRISRVTFTCEGPEYWQFLA… |
| A0A7W0FXS0 | 189-549 | None |
| V7GVR5 | 3-360 | None |
| F8CM33 | 5-379 | None |
| A4YMN2 | 77-449 | None |
| A0A2Z6RDG1 | 759-1103 | None |
| A0A6P0MCF5 | 21-324 | None |
| A0A7Z0QLY2 | 3-358 | None |
| A0A175WG83 | 19-334 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.