DPCstruct | MC244
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 192 ± 20 aa |
| Standard deviation of domain lengths | 20.33 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 13.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A661CL44 | 6-200 | FRISVYGGGGEIVVGQATKDLVENFQGEYAEDVIEAIEKEWHDTDDIEHVYGPSPDASFSVVEIDAAGEEINEAEDFNLGSGLYSRE… |
| A0A2E8UGV4 | 2-234 | KRRFRIETGRYGGEIVCGTVSKEFVQYWKDKEESQLSEHLYNLTWGDSEYVDSDSPPTPHEEWSEISDICQTYGAYSDGGFYITEIS… |
| A0A7R9TAZ7 | 1-219 | None |
| A0A344W934 | 153-347 | None |
| A0A1Z9QPC6 | 2-169 | None |
| A0A2E9C6C6 | 1-164 | None |
| A0A6V8LTV2 | 2-175 | None |
| A0A2E3DU33 | 1-181 | None |
| A0A2D9GBI6 | 2-190 | None |
| A0A1Z9XWE2 | 891-1102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.