DPCstruct | MC24396
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 227 ± 40 aa |
| Standard deviation of domain lengths | 39.60 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 21.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4D4KQ95 | 4-201 | DRVSRLADRRRLYTGETYDQARSQLKPGEPPIPAALADQRNFEAELFYTLLRSNRFTQYPFGIRRVSPGTDSITLEVESEKRAEEIL… |
| A0A7W9NES5 | 17-294 | RRLAGLRRRFTAETTSSVLPAIVQALDPVDRTTRLQLIAALGDCSASVPAEVRQLVLPDAVAPEQRALEAGILSVANRLAPAAFRMA… |
| W5W2Q4 | 10-261 | None |
| W5WNF1 | 1-217 | None |
| A0A1R0KUA9 | 4-212 | None |
| R4T0M1 | 358-570 | None |
| A0A1R3UTK6 | 5-233 | None |
| A0A327TV41 | 8-208 | None |
| A0A419VHB4 | 67-366 | None |
| A0A7G6WVT8 | 7-297 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.