DPCstruct | MC24394
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 81 ± 9 aa |
| Standard deviation of domain lengths | 8.57 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 27.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W5UE08 | 1-89 | MSRPWHKGTPCPHLEPDILGQFDTFEDWLNHATRALTGFEGSVGEELNAICVDNLGRRCHNGKDFMRARDEDAFPVRYFIQLKPLGA… |
| A0A838YVN9 | 1-80 | MNETLTLNAEVVFEFKSYFDWINNASNKFKPYGNRFPIVCVNTEGKICHNGADFMYSLQNNLYPIKAYLLQRAVNLQNEL |
| A0A4V5LW42 | 1-85 | None |
| A0A511B6F4 | 1-68 | None |
| A0A3G6RBY5 | 1-77 | None |
| A0A1V3N2M6 | 38-107 | None |
| G0J399 | 114-203 | None |
| A5V8F8 | 1-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.