DPCstruct | MC24391
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 440 ± 39 aa |
| Standard deviation of domain lengths | 38.96 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 74.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 16.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812ND17 | 24-458 | QNVVRKSDASMGTIQTMTASEIKLQVEGQVVTVASESFLAGEWRACTSKQESIAVEFTGSLPVDSSEFQLAECKARILHQIRADEDA… |
| A0A812P369 | 154-572 | AYLIKRTEPVEADKDKVFVLKDLQQDGATLEHRPFFGEQVQVEKVALQDLKQLKEWTKAVPALVEEEALQKLWPGDSEIFQDELARA… |
| A0A812WIX8 | 24-444 | None |
| A0A812LGI3 | 23-478 | None |
| A0A1Q9DWN8 | 2-478 | None |
| A0A812WQM9 | 106-596 | None |
| A0A812VEY3 | 317-736 | None |
| A0A3P8VD50 | 9-379 | None |
| A0A812M2T6 | 4-459 | None |
| A0A812Q9L0 | 408-804 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.