DPCstruct | MC2439
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 170 ± 16 aa |
| Standard deviation of domain lengths | 16.26 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 74.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 18.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G0X1I2 | 1-192 | MDLAQPLKMICSYMSKPFKKSKIDKEFFILYKIVDSYSTEFEEHYRVQCINTKVILELTVEDLVFYLYILYGLHPVQACFIGIEYAK… |
| A0A521XXM9 | 1-172 | MKLIDRIISFFRRIKPRYHLSLDSQFYNLSTKNTVYRFKVFGEHTFPKFTFEDIQNNKRILYDINPIDLIKIAIENYNEIQKKSMLR… |
| A0A849HYP8 | 1-163 | None |
| A0A0W0U3W5 | 4-161 | None |
| A0A1S2WRN8 | 10-167 | None |
| A0A364LJL5 | 1-183 | None |
| A0A378KD61 | 8-194 | None |
| A0A1E3GCG8 | 3-183 | None |
| A0A1G0IM45 | 1-135 | None |
| A0A0W0XW04 | 225-398 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.