DPCstruct | MC24386
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 248 ± 37 aa |
| Standard deviation of domain lengths | 36.66 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 35.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812KZH7 | 1-252 | MQDMCGIVAELAHGYGKWQNTECMQMKDELVELDVDGDGRIPLKVFYGQQDNAKYQFSESVQYLQEIGALDESGEKKVRIANYLQGP… |
| A0A7S2FX85 | 1-198 | CMQMKATLLELADMDVRTNGTGKVLYSNFHAERKHTTYQFTETEEYLRKYGVLDEEGDEPRVRIANYMLAPSNCIASSKHYSVCCLS… |
| A0A812TGR6 | 188-371 | None |
| A0A812RIL4 | 138-362 | None |
| A0A1Q9E6L4 | 581-809 | None |
| A0A812KES5 | 263-533 | None |
| A0A1Q9EJN2 | 708-1006 | None |
| A0A812NQU6 | 266-555 | None |
| A0A812HNK5 | 14-216 | None |
| A0A1Q9EGZ4 | 452-703 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.