DPCstruct | MC24385
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 199 ± 48 aa |
| Standard deviation of domain lengths | 47.90 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 80.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 33.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813CG64 | 20-208 | ASACYNLPMGDRFIQLGHWRLAAIDDNHFTISHKDGQTAQIFRNDGTLHPGPRRDWGAWGRSIGAAQGISFGFQFIQIGKFRVGAVD… |
| A0A812KMF6 | 5-160 | DGWTAQIFRSDGTLHPGPRRDYGTWNRQIGKSKGIMFGSNWVEIGAFRIGTIDNAHLSVAHKSGKTAQIFRNDGHLFPGPRGDFGTY… |
| A0A6V2E5S7 | 904-1081 | None |
| A0A6V2E475 | 397-588 | None |
| A0A812QL38 | 180-525 | None |
| A0A812QP76 | 195-389 | None |
| A0A1Q9E8I0 | 461-761 | None |
| A0A1Q9DZT6 | 450-632 | None |
| A0A812ZCG1 | 81-279 | None |
| A0A812P872 | 2-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.