DPCstruct | MC24380
Metacluster Properties and Pfam Annotations
| Number of structural domains | 96 |
|---|---|
| Mean domain length (aa) | 204 ± 41 aa |
| Standard deviation of domain lengths | 41.23 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 84.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 27.28 |
| Pfam Score | 99.22 |
| Assigned Pfam label(s) | CL0105- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812IYZ7 | 7-223 | SAMSANNPTAGILGRKVGMTQVFDESGSVVPVTVVQAGPCHVLQVKTLDRDGYEAIQVGFLDKPRRLASRSERGHVAKLESKRAKKR… |
| A0A6I9KS13 | 24-246 | VTIVETPPMVVVGIVGYVETPRGLRTFKTVFAEHISDECKRRFYKNWHKSKKKAFTKYCKKWQDDDGKKQLEKDFSSMKKYCQVIRV… |
| A0A836DAL2 | 1-234 | None |
| A0A6V7WI20 | 73-288 | None |
| A0A7R8X4X2 | 430-675 | None |
| A0A066WFN5 | 115-361 | None |
| A0A1A9X6B4 | 1-158 | None |
| A0A1I8ITS3 | 245-471 | None |
| A0A4S4DGF3 | 178-369 | None |
| A0A4S4DG59 | 39-271 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.