DPCstruct | MC2438
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 131 ± 24 aa |
| Standard deviation of domain lengths | 23.55 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01724 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B7KEG4 | 4-120 | LYDTDYLIWTEKQAELLRDRKFEQLDLENLIEEVEDLGKSELRTCRSGAILIIIHLLYLRYWEAELERNQFQWQAEIDNWRVQLESR… |
| A0A841UML7 | 2-119 | ADLLASGRFSELDIENLVEEVRDLSKRERDRLLASLRLILHHLLKWEYQPQRRSRGWLGTIQGERANIRLYLDDSPSLRRYLTDESL… |
| A0A1Z4L734 | 58-160 | None |
| A0A3S0CNN8 | 199-354 | None |
| A0A853HRE9 | 4-151 | None |
| A0A7Z7I257 | 36-176 | None |
| A0A1N6FVV3 | 4-141 | None |
| A0A450RX49 | 129-270 | None |
| A0A4R4DXP7 | 2-144 | None |
| A0A4R4D3W0 | 60-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.