DPCstruct | MC24379
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 207 ± 19 aa |
| Standard deviation of domain lengths | 18.53 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 32.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812IB76 | 4-197 | RDMQCYVVLTIQSWRRGRPLVPAAADELAQEERQRLHAFDVTTIDAGKRHGLASWVRYHPRMVGSSSFLLSEYLTLFLERIGEQASL… |
| A0A812ZU48 | 323-544 | ESGRRVAQYYLNRPGISQLRALDQQFYVVLTIQTFKRGFPLIPVCSGEEHEDVTRIDAGNHLGLSTWVRYDPAKDGIDGFYLSGYMQ… |
| A0A1Q9DEM0 | 202-397 | None |
| A0A812JLJ3 | 218-412 | None |
| A0A812JAP0 | 107-326 | None |
| A0A812I4C3 | 202-423 | None |
| A0A812X2C5 | 302-492 | None |
| A0A812LDK7 | 615-837 | None |
| A0A1Q9DMA2 | 27-212 | None |
| A0A813AIW3 | 121-287 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.